PDB entry 1gyv

View 1gyv on RCSB PDB site
Description: gamma-adaptin appendage domain from clathrin adaptor ap1, l762e mutant
Class: endocytosis
Keywords: endocytosis, adaptor, clathrin, golgi, adaptin
Deposited on 2002-04-30, released 2002-08-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.182
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: adapter-related protein complex 1 gamma 1 subunit
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PDB 1GYV (0-0)
    • engineered mutation (59)
  • Uniprot P22892 (1-119)
  Domains in SCOPe 2.02: d1gyva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gyvA (A:)
  mipsitaysknglkieftfersntnpsvtvitiqasnsteldmtdfvfqaavpktfqlqe
  lspsssvvpafntgtitqvikvlnpqkqqlrmrikltynhkgsamqdlaevnnfppqswq