Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (6 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.2: NTF2-like [54431] (3 proteins) |
Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries) |
Domain d1gy6b_: 1gy6 B: [70737] |
PDB Entry: 1gy6 (more details), 1.6 Å
SCOP Domain Sequences for d1gy6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy6b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)} dkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfq kiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrla lhn
Timeline for d1gy6b_: