Lineage for d1gy6b_ (1gy6 B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 254865Fold d.17: Cystatin-like [54402] (5 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 255033Superfamily d.17.4: NTF2-like [54427] (6 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 255054Family d.17.4.2: NTF2-like [54431] (3 proteins)
  6. 255063Protein Nuclear transport factor-2 (NTF2) [54432] (3 species)
  7. 255076Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries)
  8. 255078Domain d1gy6b_: 1gy6 B: [70737]

Details for d1gy6b_

PDB Entry: 1gy6 (more details), 1.6 Å

PDB Description: ntf2 from rat, ammonium sulphate conditions

SCOP Domain Sequences for d1gy6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gy6b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
dkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfq
kiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrla
lhn

SCOP Domain Coordinates for d1gy6b_:

Click to download the PDB-style file with coordinates for d1gy6b_.
(The format of our PDB-style files is described here.)

Timeline for d1gy6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1gy6a_