Lineage for d1gy6b_ (1gy6 B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.2: NTF2-like [54431] (3 proteins) Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries) 
Domain d1gy6b_: 1gy6 B: [70737]
Details for d1gy6b_
PDB Entry: 1gy6 (more details), 1.6 Å
PDB Description: ntf2 from rat, ammonium sulphate conditions
SCOP Domain Sequences for d1gy6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gy6b_ d.17.4.2 (B:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
dkpiweqigssfiqhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfq
kiqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndmfrla
lhn
SCOP Domain Coordinates for d1gy6b_:
Click to download the PDB-style file with coordinates for d1gy6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gy6b_:
- d1gy6b_ is new in SCOP 1.61
- d1gy6b_ appears in SCOP 1.63
- d1gy6b_ appears in the current release, SCOPe 2.08
View in 3D
