Lineage for d1gwnc_ (1gwn C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2447791Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2448760Protein RhoE (RND3) [75201] (1 species)
  7. 2448761Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries)
  8. 2448764Domain d1gwnc_: 1gwn C: [70673]
    complexed with gtp, mg

Details for d1gwnc_

PDB Entry: 1gwn (more details), 2.1 Å

PDB Description: the crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
PDB Compounds: (C:) rho-related GTP-binding protein rhoe

SCOPe Domain Sequences for d1gwnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwnc_ c.37.1.8 (C:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}
kckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgsp
yydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrtd
vstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk

SCOPe Domain Coordinates for d1gwnc_:

Click to download the PDB-style file with coordinates for d1gwnc_.
(The format of our PDB-style files is described here.)

Timeline for d1gwnc_: