Lineage for d1gwnc_ (1gwn C:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) 
Family c.37.1.8: G proteins [52592] (26 proteins) 
Protein RhoE (RND3) [75201] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [75202] (2 PDB entries) 
Domain d1gwnc_: 1gwn C: [70673]
Details for d1gwnc_
PDB Entry: 1gwn (more details), 2.1 Å
PDB Description: the crystal structure of the core domain of rhoe/rnd3 - a constitutively activated small g protein
SCOP Domain Sequences for d1gwnc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwnc_ c.37.1.8 (C:) RhoE (RND3) {Mouse (Mus musculus)}
kckivvvgdsqcgktallhvfakdcfpenyvptvfenytasfeidtqrielslwdtsgsp
yydnvrplsypdsdavlicfdisrpetldsvlkkwkgeiqefcpntkmllvgcksdlrtd
vstlvelsnhrqtpvsydqganmakqigaatyiecsalqsensvrdifhvatlacvnk
SCOP Domain Coordinates for d1gwnc_:
Click to download the PDB-style file with coordinates for d1gwnc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gwnc_:
- d1gwnc_ is new in SCOP 1.61
- d1gwnc_ appears in SCOP 1.63
- d1gwnc_ appears in the current release, SCOPe 2.08
View in 3D
