SCOPe 2.02: Domain d1gwcc2: 1gwc C:4-86

Lineage for d1gwcc2 (1gwc C:4-86)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class tau GST [81365] (2 species)

7. Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [75236] (1 PDB entry)

8. Domain d1gwcc2: 1gwc C:4-86 [70665]
   Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1
   complexed with gtx, so4

Details for d1gwcc2

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

PDB Compounds: (C:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwcc2:

Sequence; same for both SEQRES and ATOM records:

>d1gwcc2 c.47.1.5 (C:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

Timeline for d1gwcc2:

• d1gwcc2 first appeared in SCOP 1.61
  
• d1gwcc2 appears in SCOPe 2.01
  
• d1gwcc2 appears in SCOPe 2.03
  
• d1gwcc2 appears in the current release, SCOPe 2.08