Lineage for d1gwcb1 (1gwc B:87-224)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089704Protein Class tau GST [81354] (2 species)
  7. 1089705Species Aegilops tauschii, also known as Triticum tauschii [TaxId:37682] [74726] (1 PDB entry)
  8. 1089707Domain d1gwcb1: 1gwc B:87-224 [70662]
    Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2
    complexed with gtx, so4

Details for d1gwcb1

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification
PDB Compounds: (B:) glutathione s-transferase tsi-1

SCOPe Domain Sequences for d1gwcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwcb1 a.45.1.1 (B:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea

SCOPe Domain Coordinates for d1gwcb1:

Click to download the PDB-style file with coordinates for d1gwcb1.
(The format of our PDB-style files is described here.)

Timeline for d1gwcb1: