SCOP 1.61: Domain d1gwcb1: 1gwc B:87-224

Lineage for d1gwcb1 (1gwc B:87-224)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)

6. Protein Glutathione S-transferase [47618] (27 species)

7. Species Wheat (Triticum tauschii l.), class tau [74726] (1 PDB entry)

8. Domain d1gwcb1: 1gwc B:87-224 [70662]
   Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2

Details for d1gwcb1

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwcb1:

Sequence; same for both SEQRES and ATOM records:

>d1gwcb1 a.45.1.1 (B:87-224) Glutathione S-transferase {Wheat (Triticum tauschii l.), class tau}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea

Timeline for d1gwcb1:

• d1gwcb1 is new in SCOP 1.61
  
• d1gwcb1 appears in SCOP 1.63
  
• d1gwcb1 appears in the current release, SCOPe 2.08