SCOP 1.63: Domain d1gwcb1: 1gwc B:87-224

Lineage for d1gwcb1 (1gwc B:87-224)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class tau GST [81354] (1 species)

7. Species Wheat (Triticum tauschii l.) [74726] (1 PDB entry)

8. Domain d1gwcb1: 1gwc B:87-224 [70662]
   Other proteins in same PDB: d1gwca2, d1gwcb2, d1gwcc2

Details for d1gwcb1

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwcb1:

Sequence; same for both SEQRES and ATOM records:

>d1gwcb1 a.45.1.1 (B:87-224) Class tau GST {Wheat (Triticum tauschii l.)}
llpadpyeraiarfwvayvddklvapwrqwlrgkteeeksegkkqafaavgvlegalrec
skgggffggdgvglvdvalggvlswmkvtealsgdkifdaaktpllaawverfieldaak
aalpdvgrllefakarea

Timeline for d1gwcb1:

• d1gwcb1 first appeared in SCOP 1.61
  
• d1gwcb1 appears in SCOP 1.65
  
• d1gwcb1 appears in the current release, SCOPe 2.08