| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins) |
| Protein Class tau GST [81365] (1 species) |
| Species Wheat (Triticum tauschii l.) [75236] (1 PDB entry) |
| Domain d1gwcc2: 1gwc C:4-86 [70665] Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1 complexed with gtx, so4 |
PDB Entry: 1gwc (more details), 2.25 Å
SCOP Domain Sequences for d1gwcc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gwcc2 c.47.1.5 (C:4-86) Class tau GST {Wheat (Triticum tauschii l.)}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps
Timeline for d1gwcc2:
View in 3DDomains from other chains: (mouse over for more information) d1gwca1, d1gwca2, d1gwcb1, d1gwcb2 |