Lineage for d1gwcc2 (1gwc C:4-86)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 244778Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 244779Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 244918Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)
  6. 245209Protein Class tau GST [81365] (1 species)
  7. 245210Species Wheat (Triticum tauschii l.) [75236] (1 PDB entry)
  8. 245213Domain d1gwcc2: 1gwc C:4-86 [70665]
    Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1
    complexed with gtx, so4

Details for d1gwcc2

PDB Entry: 1gwc (more details), 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gwcc2 c.47.1.5 (C:4-86) Class tau GST {Wheat (Triticum tauschii l.)}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

SCOP Domain Coordinates for d1gwcc2:

Click to download the PDB-style file with coordinates for d1gwcc2.
(The format of our PDB-style files is described here.)

Timeline for d1gwcc2: