SCOP 1.61: Domain d1gwcb2: 1gwc B:4-86

Lineage for d1gwcb2 (1gwc B:4-86)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (27 species)

7. Species Wheat (Triticum tauschii l.), class tau [75236] (1 PDB entry)

8. Domain d1gwcb2: 1gwc B:4-86 [70663]
   Other proteins in same PDB: d1gwca1, d1gwcb1, d1gwcc1

Details for d1gwcb2

PDB Entry: 1gwc, 2.25 Å

PDB Description: the structure of a tau class glutathione s-transferase from wheat, active in herbicide detoxification

SCOP Domain Sequences for d1gwcb2:

Sequence; same for both SEQRES and ATOM records:

>d1gwcb2 c.47.1.5 (B:4-86) Glutathione S-transferase {Wheat (Triticum tauschii l.), class tau}
gddlkllgawpspfvtrvklalalkglsyedveedlykkselllksnpvhkkipvlihng
apvcesmiilqyidevfastgps

Timeline for d1gwcb2:

• d1gwcb2 is new in SCOP 1.61
  
• d1gwcb2 appears in SCOP 1.63
  
• d1gwcb2 appears in the current release, SCOPe 2.08