Lineage for d1gvia1 (1gvi A:1-123)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160787Protein Maltogenic amylase, N-terminal domain [49221] (4 species)
  7. 160809Species Thermus sp. [TaxId:275] [49222] (2 PDB entries)
  8. 160810Domain d1gvia1: 1gvi A:1-123 [70604]
    Other proteins in same PDB: d1gvia2, d1gvia3, d1gvib2, d1gvib3

Details for d1gvia1

PDB Entry: 1gvi (more details), 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd

SCOP Domain Sequences for d1gvia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvia1 b.1.1.5 (A:1-123) Maltogenic amylase, N-terminal domain {Thermus sp.}
mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
hrv

SCOP Domain Coordinates for d1gvia1:

Click to download the PDB-style file with coordinates for d1gvia1.
(The format of our PDB-style files is described here.)

Timeline for d1gvia1: