Lineage for d1gvia3 (1gvi A:124-505)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 protein domains)
  6. 173367Protein Maltogenic amylase, central domain [51465] (4 species)
  7. 173389Species Thermus sp. [TaxId:275] [51466] (2 PDB entries)
  8. 173390Domain d1gvia3: 1gvi A:124-505 [70606]
    Other proteins in same PDB: d1gvia1, d1gvia2, d1gvib1, d1gvib2

Details for d1gvia3

PDB Entry: 1gvi (more details), 3.3 Å

PDB Description: thermus maltogenic amylase in complex with beta-cd

SCOP Domain Sequences for d1gvia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gvia3 c.1.8.1 (A:124-505) Maltogenic amylase, central domain {Thermus sp.}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

SCOP Domain Coordinates for d1gvia3:

Click to download the PDB-style file with coordinates for d1gvia3.
(The format of our PDB-style files is described here.)

Timeline for d1gvia3: