PDB entry 1gvi

View 1gvi on RCSB PDB site
Description: thermus maltogenic amylase in complex with beta-cd
Deposited on 2002-02-14, released 2002-06-06
The last revision prior to the SCOP 1.61 freeze date was dated 2002-06-06, with a file datestamp of 2002-06-06.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.192
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gviA (A:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gviB (B:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw