Lineage for d1gthc2 (1gth C:533-844)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 305374Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 305375Family c.1.4.1: FMN-linked oxidoreductases [51396] (12 proteins)
  6. 305414Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 305415Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 305430Domain d1gthc2: 1gth C:533-844 [70494]
    Other proteins in same PDB: d1gtha1, d1gtha3, d1gtha4, d1gtha5, d1gthb1, d1gthb3, d1gthb4, d1gthb5, d1gthc1, d1gthc3, d1gthc4, d1gthc5, d1gthd1, d1gthd3, d1gthd4, d1gthd5

Details for d1gthc2

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil

SCOP Domain Sequences for d1gthc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gthc2 c.1.4.1 (C:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOP Domain Coordinates for d1gthc2:

Click to download the PDB-style file with coordinates for d1gthc2.
(The format of our PDB-style files is described here.)

Timeline for d1gthc2: