SCOP 1.65: Domain d1gthd3: 1gth D:288-440

Lineage for d1gthd3 (1gth D:288-440)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (4 proteins)

6. Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries)

8. Domain d1gthd3: 1gth D:288-440 [70500]
   Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha4, d1gtha5, d1gthb1, d1gthb2, d1gthb4, d1gthb5, d1gthc1, d1gthc2, d1gthc4, d1gthc5, d1gthd1, d1gthd2, d1gthd4, d1gthd5
   complexed with fad, fmn, fs4, idh, iur, ndp, ura

Details for d1gthd3

PDB Entry: 1gth, 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil

SCOP Domain Sequences for d1gthd3:

Sequence; same for both SEQRES and ATOM records:

>d1gthd3 c.3.1.1 (D:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa)}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs

Timeline for d1gthd3:

• d1gthd3 first appeared in SCOP 1.61
  
• d1gthd3 appears in SCOP 1.63
  
• d1gthd3 appears in SCOP 1.67
  
• d1gthd3 appears in the current release, SCOPe 2.08