Lineage for d1gthc5 (1gth C:845-1020)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328743Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 328830Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (7 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 328837Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 328838Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 328853Domain d1gthc5: 1gth C:845-1020 [70497]
    Other proteins in same PDB: d1gtha1, d1gtha2, d1gtha3, d1gtha4, d1gthb1, d1gthb2, d1gthb3, d1gthb4, d1gthc1, d1gthc2, d1gthc3, d1gthc4, d1gthd1, d1gthd2, d1gthd3, d1gthd4

Details for d1gthc5

PDB Entry: 1gth (more details), 2.25 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and 5-iodouracil

SCOP Domain Sequences for d1gthc5:

Sequence, based on SEQRES records: (download)

>d1gthc5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

Sequence, based on observed residues (ATOM records): (download)

>d1gthc5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnale
rkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgy
qaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

SCOP Domain Coordinates for d1gthc5:

Click to download the PDB-style file with coordinates for d1gthc5.
(The format of our PDB-style files is described here.)

Timeline for d1gthc5: