Lineage for d1gted2 (1gte D:533-844)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338072Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1338073Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 1338180Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 1338181Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 1338185Domain d1gted2: 1gte D:533-844 [70456]
    Other proteins in same PDB: d1gtea1, d1gtea3, d1gtea4, d1gtea5, d1gteb1, d1gteb3, d1gteb4, d1gteb5, d1gtec1, d1gtec3, d1gtec4, d1gtec5, d1gted1, d1gted3, d1gted4, d1gted5
    complexed with fad, fmn, iur, sf4

Details for d1gted2

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gted2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gted2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOPe Domain Coordinates for d1gted2:

Click to download the PDB-style file with coordinates for d1gted2.
(The format of our PDB-style files is described here.)

Timeline for d1gted2: