| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) ![]() |
| Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins) |
| Protein Dihydropyrimidine dehydrogenase, domain 3 [51911] (1 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [51912] (5 PDB entries) |
| Domain d1gtec3: 1gte C:288-440 [70452] Other proteins in same PDB: d1gtea1, d1gtea2, d1gtea4, d1gtea5, d1gteb1, d1gteb2, d1gteb4, d1gteb5, d1gtec1, d1gtec2, d1gtec4, d1gtec5, d1gted1, d1gted2, d1gted4, d1gted5 complexed with fad, fmn, iur, sf4 |
PDB Entry: 1gte (more details), 1.65 Å
SCOPe Domain Sequences for d1gtec3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtec3 c.3.1.1 (C:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]}
pktddifqgltqdqgfytskdflplvaksskagmcachsplpsirgavivlgagdtafdc
atsalrcgarrvflvfrkgfvniravpeevelakeekceflpflsprkvivkggrivavq
fvrteqdetgkwnededqivhlkadvvisafgs
Timeline for d1gtec3:
View in 3DDomains from same chain: (mouse over for more information) d1gtec1, d1gtec2, d1gtec4, d1gtec5 |