Lineage for d1gted2 (1gte D:533-844)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 172977Superfamily c.1.4: FMN-linked oxidoreductases [51395] (1 family) (S)
  5. 172978Family c.1.4.1: FMN-linked oxidoreductases [51396] (11 proteins)
  6. 173008Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 173009Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 173013Domain d1gted2: 1gte D:533-844 [70456]
    Other proteins in same PDB: d1gtea1, d1gtea3, d1gtea4, d1gtea5, d1gteb1, d1gteb3, d1gteb4, d1gteb5, d1gtec1, d1gtec3, d1gtec4, d1gtec5, d1gted1, d1gted3, d1gted4, d1gted5

Details for d1gted2

PDB Entry: 1gte (more details), 1.65 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, binary complex with 5- iodouracil

SCOP Domain Sequences for d1gted2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gted2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa)}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

SCOP Domain Coordinates for d1gted2:

Click to download the PDB-style file with coordinates for d1gted2.
(The format of our PDB-style files is described here.)

Timeline for d1gted2: