Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries) |
Domain d1gted2: 1gte D:533-844 [70456] Other proteins in same PDB: d1gtea1, d1gtea3, d1gtea4, d1gtea5, d1gteb1, d1gteb3, d1gteb4, d1gteb5, d1gtec1, d1gtec3, d1gtec4, d1gtec5, d1gted1, d1gted3, d1gted4, d1gted5 complexed with fad, fmn, iur, sf4 |
PDB Entry: 1gte (more details), 1.65 Å
SCOPe Domain Sequences for d1gted2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gted2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
Timeline for d1gted2:
View in 3D Domains from same chain: (mouse over for more information) d1gted1, d1gted3, d1gted4, d1gted5 |