Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families) |
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species) includes linker from domain 4 |
Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries) |
Domain d1gt8c5: 1gt8 C:845-1020 [70432] Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a4, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d4 |
PDB Entry: 1gt8 (more details), 3.3 Å
SCOP Domain Sequences for d1gt8c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gt8c5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
Timeline for d1gt8c5:
View in 3D Domains from same chain: (mouse over for more information) d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c4 |