Lineage for d1gt8c5 (1gt8 C:845-1020)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 191936Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (5 families) (S)
  5. 192023Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (6 proteins)
  6. 192030Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
  7. 192031Species Pig (Sus scrofa) [TaxId:9823] [54892] (5 PDB entries)
  8. 192050Domain d1gt8c5: 1gt8 C:845-1020 [70432]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a4, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d4

Details for d1gt8c5

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid

SCOP Domain Sequences for d1gt8c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8c5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa)}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

SCOP Domain Coordinates for d1gt8c5:

Click to download the PDB-style file with coordinates for d1gt8c5.
(The format of our PDB-style files is described here.)

Timeline for d1gt8c5: