Lineage for d1fv0a_ (1fv0 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733242Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2733270Domain d1fv0a_: 1fv0 A: [70147]
    complexed with aristolochic acid
    complexed with 9ar, act, dio, gol, so4

Details for d1fv0a_

PDB Entry: 1fv0 (more details), 1.7 Å

PDB Description: first structural evidence of the inhibition of phospholipase a2 by aristolochic acid: crystal structure of a complex formed between phospholipase a2 and aristolochic acid
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1fv0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fv0a_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1fv0a_:

Click to download the PDB-style file with coordinates for d1fv0a_.
(The format of our PDB-style files is described here.)

Timeline for d1fv0a_: