PDB entry 1fv0

View 1fv0 on RCSB PDB site
Description: first structural evidence of the inhibition of phospholipase a2 by aristolochic acid: crystal structure of a complex formed between phospholipase a2 and aristolochic acid
Class: toxin
Keywords: phospholipase A2, Daboia russelli pulchella, neurotoxic, edema, TOXIN
Deposited on 2000-09-18, released 2002-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fv0a_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fv0b_
  • Heterogens: SO4, ACT, 9AR, GOL, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fv0A (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fv0B (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c