![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.6: omega toxin-like [57059] (5 families) ![]() |
![]() | Family g.3.6.2: Spider toxins [57072] (26 proteins) |
![]() | Protein Tachystatin [75666] (1 species) |
![]() | Species Japanese horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [75667] (1 PDB entry) |
![]() | Domain d1cixa_: 1cix A: [70066] |
PDB Entry: 1cix (more details)
SCOPe Domain Sequences for d1cixa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cixa_ g.3.6.2 (A:) Tachystatin {Japanese horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} ysrcqlqgfncvvrsyglptipccrgltcrsyfpgstygrcqry
Timeline for d1cixa_: