PDB entry 1cix

View 1cix on RCSB PDB site
Description: three-dimensional structure of antimicrobial peptide tachystatin a isolated from horseshoe crab
Class: antimicrobial peptide
Keywords: antimicrobial peptide, chitin-binding peptide
Deposited on 1999-04-06, released 2002-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (tachystatin a)
  Species: Tachypleus tridentatus [TaxId:6853]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9U8X3 (0-43)
  Domains in SCOPe 2.08: d1cixa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1cixA (A:)
  ysrcqlqgfncvvrsyglptipccrgltcrsyfpgstygrcqry