Lineage for d1kswa2 (1ksw A:146-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965246Protein c-src tyrosine kinase [55556] (4 species)
  7. 2965253Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 2965304Domain d1kswa2: 1ksw A:146-248 [68861]
    Other proteins in same PDB: d1kswa1, d1kswa3
    complexed with nbs; mutant

Details for d1kswa2

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1kswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOPe Domain Coordinates for d1kswa2:

Click to download the PDB-style file with coordinates for d1kswa2.
(The format of our PDB-style files is described here.)

Timeline for d1kswa2: