Lineage for d1kswa2 (1ksw A:146-248)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135973Fold d.93: SH2-like [55549] (1 superfamily)
  4. 135974Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 135975Family d.93.1.1: SH2 domain [55551] (20 proteins)
  6. 135979Protein c-src tyrosine kinase [55556] (3 species)
  7. 135984Species Human (Homo sapiens) [TaxId:9606] [55557] (13 PDB entries)
  8. 136002Domain d1kswa2: 1ksw A:146-248 [68861]
    Other proteins in same PDB: d1kswa1, d1kswa3

Details for d1kswa2

PDB Entry: 1ksw (more details), 2.8 Å

PDB Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp

SCOP Domain Sequences for d1kswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kswa2 d.93.1.1 (A:146-248) c-src tyrosine kinase {Human (Homo sapiens)}
eewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOP Domain Coordinates for d1kswa2:

Click to download the PDB-style file with coordinates for d1kswa2.
(The format of our PDB-style files is described here.)

Timeline for d1kswa2: