Lineage for d1khca_ (1khc A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 227526Fold b.34: SH3-like barrel [50036] (12 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 227967Superfamily b.34.9: Tudor/PWWP [63748] (2 families) (S)
  5. 227972Family b.34.9.2: PWWP domain [69250] (1 protein)
    includes the C-terminal all-alpha subdomain
  6. 227973Protein DNA methyltransferase DNMT3B [69251] (1 species)
  7. 227974Species Mouse (Mus musculus) [TaxId:10090] [69252] (1 PDB entry)
  8. 227975Domain d1khca_: 1khc A: [68608]

Details for d1khca_

PDB Entry: 1khc (more details), 1.8 Å

PDB Description: Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b

SCOP Domain Sequences for d1khca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus)}
teyqddkefgigdlvwgkikgfswwpamvvswkatskrqampgmrwvqwfgdgkfseisa
dklvalglfsqhfnlatfnklvsyrkamyhtlekarvragktfssspgesledqlkpmle
wahggfkptgieglkpn

SCOP Domain Coordinates for d1khca_:

Click to download the PDB-style file with coordinates for d1khca_.
(The format of our PDB-style files is described here.)

Timeline for d1khca_: