Lineage for d1khca_ (1khc A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.34: SH3-like barrel [50036] (10 superfamilies) 
Superfamily b.34.9: Tudor/PWWP [63748] (2 families) 
Family b.34.9.2: PWWP domain [69250] (1 protein) Protein DNA methyltransferase DNMT3B [69251] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [69252] (1 PDB entry) 
Domain d1khca_: 1khc A: [68608]
Details for d1khca_
PDB Entry: 1khc (more details), 1.8 Å
PDB Description: Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b
SCOP Domain Sequences for d1khca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1khca_ b.34.9.2 (A:) DNA methyltransferase DNMT3B {Mouse (Mus musculus)}
teyqddkefgigdlvwgkikgfswwpamvvswkatskrqampgmrwvqwfgdgkfseisa
dklvalglfsqhfnlatfnklvsyrkamyhtlekarvragktfssspgesledqlkpmle
wahggfkptgieglkpn
SCOP Domain Coordinates for d1khca_:
Click to download the PDB-style file with coordinates for d1khca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1khca_:
- d1khca_ first appeared in SCOP 1.59
- d1khca_ appears in SCOP 1.63
- d1khca_ appears in the current release, SCOPe 2.08
View in 3D