Lineage for d1kfqb1 (1kfq B:2-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. 2910135Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin, N-terminal domain [419004] (1 species)
  7. 2910136Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [419476] (2 PDB entries)
  8. 2910140Domain d1kfqb1: 1kfq B:2-205 [68567]
    Other proteins in same PDB: d1kfqa2, d1kfqa3, d1kfqa4, d1kfqb2, d1kfqb3, d1kfqb4
    complexed with ca
    has additional insertions and/or extensions that are not grouped together

Details for d1kfqb1

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
PDB Compounds: (B:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqb1 c.84.1.1 (B:2-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin, N-terminal domain {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
qqvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknvl
fvggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgnciggi
iltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinld
qigvykfegtrlekshfevkvvdt

SCOPe Domain Coordinates for d1kfqb1:

Click to download the PDB-style file with coordinates for d1kfqb1.
(The format of our PDB-style files is described here.)

Timeline for d1kfqb1: