Lineage for d1kfqb2 (1kfq B:206-323)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain [419005] (1 species)
  7. Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [419477] (2 PDB entries)
  8. 2910133Domain d1kfqb2: 1kfq B:206-323 [68568]
    Other proteins in same PDB: d1kfqa1, d1kfqa4, d1kfqb1, d1kfqb4
    complexed with ca

Details for d1kfqb2

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form
PDB Compounds: (B:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqb2 c.84.1.1 (B:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
vqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgvagpyakhifgtllgcskesllncd
psedfggghpdpnltyahdlvelldihkkkdvgtvpqfgaacdgdadrnmilgrqffv

SCOPe Domain Coordinates for d1kfqb2:

Click to download the PDB-style file with coordinates for d1kfqb2.
(The format of our PDB-style files is described here.)

Timeline for d1kfqb2: