Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins) |
Domain d1kfqb2: 1kfq B:206-323 [68568] Other proteins in same PDB: d1kfqa1, d1kfqa4, d1kfqb1, d1kfqb4 complexed with ca |
PDB Entry: 1kfq (more details), 2.4 Å
SCOPe Domain Sequences for d1kfqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfqb2 c.84.1.1 (B:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin, middle and C-terminal domain {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} vqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgvagpyakhifgtllgcskesllncd psedfggghpdpnltyahdlvelldihkkkdvgtvpqfgaacdgdadrnmilgrqffv
Timeline for d1kfqb2:
View in 3D Domains from other chains: (mouse over for more information) d1kfqa1, d1kfqa2, d1kfqa3, d1kfqa4 |