Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins) Pfam PF00408 |
Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69811] (1 species) |
Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69812] (2 PDB entries) |
Domain d1kfqa4: 1kfq A:444-572 [68566] Other proteins in same PDB: d1kfqa1, d1kfqa2, d1kfqa3, d1kfqb1, d1kfqb2, d1kfqb3 complexed with ca |
PDB Entry: 1kfq (more details), 2.4 Å
SCOPe Domain Sequences for d1kfqa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kfqa4 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} rnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnkadiydyvdpvdqsvsknqgvr fvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhetatalaniiklgleisdiaqft grneptvit
Timeline for d1kfqa4:
View in 3D Domains from other chains: (mouse over for more information) d1kfqb1, d1kfqb2, d1kfqb3, d1kfqb4 |