Lineage for d1kfqa4 (1kfq A:444-572)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 137429Fold d.129: TBP-like [55944] (4 superfamilies)
  4. 137535Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (1 family) (S)
  5. 137536Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (2 proteins)
  6. 137537Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69811] (1 species)
  7. 137538Species Paramecium tetraurelia [TaxId:5888] [69812] (2 PDB entries)
  8. 137541Domain d1kfqa4: 1kfq A:444-572 [68566]
    Other proteins in same PDB: d1kfqa1, d1kfqa2, d1kfqa3, d1kfqb1, d1kfqb2, d1kfqb3

Details for d1kfqa4

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form

SCOP Domain Sequences for d1kfqa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqa4 d.129.2.1 (A:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia}
rnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnkadiydyvdpvdqsvsknqgvr
fvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhetatalaniiklgleisdiaqft
grneptvit

SCOP Domain Coordinates for d1kfqa4:

Click to download the PDB-style file with coordinates for d1kfqa4.
(The format of our PDB-style files is described here.)

Timeline for d1kfqa4: