Lineage for d1kfqb1 (1kfq B:2-205)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127595Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 127596Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 127597Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 127598Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69605] (1 species)
  7. 127599Species Paramecium tetraurelia [TaxId:5888] [69606] (2 PDB entries)
  8. 127609Domain d1kfqb1: 1kfq B:2-205 [68567]
    Other proteins in same PDB: d1kfqa4, d1kfqb4

Details for d1kfqb1

PDB Entry: 1kfq (more details), 2.4 Å

PDB Description: crystal structure of exocytosis-sensitive phosphoprotein, pp63/parafusin (phosphoglucomutse) from paramecium. open form

SCOP Domain Sequences for d1kfqb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfqb1 c.84.1.1 (B:2-205) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Paramecium tetraurelia}
qqvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknvl
fvggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgnciggi
iltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinld
qigvykfegtrlekshfevkvvdt

SCOP Domain Coordinates for d1kfqb1:

Click to download the PDB-style file with coordinates for d1kfqb1.
(The format of our PDB-style files is described here.)

Timeline for d1kfqb1: