Lineage for d1kfib2 (1kfi B:206-323)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2517507Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2517508Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2517509Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 2517510Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69605] (1 species)
  7. 2517511Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69606] (2 PDB entries)
  8. 2517516Domain d1kfib2: 1kfi B:206-323 [68560]
    Other proteins in same PDB: d1kfia4, d1kfib4
    complexed with so4, zn

Details for d1kfib2

PDB Entry: 1kfi (more details), 2.4 Å

PDB Description: Crystal Structure of the Exocytosis-Sensitive Phosphoprotein, pp63/Parafusin (phosphoglucomutase) from Paramecium
PDB Compounds: (B:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfib2 c.84.1.1 (B:206-323) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
vqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgvagpyakhifgtllgcskesllncd
psedfggghpdpnltyahdlvelldihkkkdvgtvpqfgaacdgdadrnmilgrqffv

SCOPe Domain Coordinates for d1kfib2:

Click to download the PDB-style file with coordinates for d1kfib2.
(The format of our PDB-style files is described here.)

Timeline for d1kfib2: