PDB entry 1kfi

View 1kfi on RCSB PDB site
Description: Crystal Structure of the Exocytosis-Sensitive Phosphoprotein, pp63/Parafusin (phosphoglucomutase) from Paramecium
Class: isomerase
Keywords: parafusin, phosphoprotein pp63, exocytosis, ISOMERASE
Deposited on 2001-11-21, released 2002-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.227
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucomutase 1
    Species: Paramecium tetraurelia [TaxId:5888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kfia1, d1kfia2, d1kfia3, d1kfia4
  • Chain 'B':
    Compound: phosphoglucomutase 1
    Species: Paramecium tetraurelia [TaxId:5888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kfib1, d1kfib2, d1kfib3, d1kfib4
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kfiA (A:)
    mqqvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknv
    lfvggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgncigg
    iiltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinl
    dqigvykfegtrlekshfevkvvdtvqdytqlmqklfdfdllkglfsnkdfsfrfdgmhg
    vagpyakhifgtllgcskesllncdpsedfggghpdpnltyahdlvelldihkkkdvgtv
    pqfgaacdgdadrnmilgrqffvtpsdslaviaananlifkngllgaarsmptsgaldkv
    aakngiklfetptgwkffgnlmdaglinlcgeesfgtgsnhirekdgiwavlawltilah
    knkntdhfvtveeivtqywqqfgrnyysrydyeqvdsagankmmehlktkfqyfeqlkqg
    nkadiydyvdpvdqsvsknqgvrfvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqh
    etatalaniiklgleisdiaqftgrneptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfiA (A:)
    qvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknvlf
    vggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgnciggii
    ltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinldq
    igvykfegtrlekshfevkvvdtvqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgva
    gpyakhifgtllgcskesllncdpsedfggghpdpnltyahdlvelldihkkkdvgtvpq
    fgaacdgdadrnmilgrqffvtpsdslaviaananlifkngllgaarsmptsgaldkvaa
    kngiklfetptgwkffgnlmdaglinlcgeesfgtgsnhirekdgiwavlawltilahkn
    kntdhfvtveeivtqywqqfgrnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnk
    adiydyvdpvdqsvsknqgvrfvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhet
    atalaniiklgleisdiaqftgrneptvit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kfiB (B:)
    mqqvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknv
    lfvggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgncigg
    iiltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinl
    dqigvykfegtrlekshfevkvvdtvqdytqlmqklfdfdllkglfsnkdfsfrfdgmhg
    vagpyakhifgtllgcskesllncdpsedfggghpdpnltyahdlvelldihkkkdvgtv
    pqfgaacdgdadrnmilgrqffvtpsdslaviaananlifkngllgaarsmptsgaldkv
    aakngiklfetptgwkffgnlmdaglinlcgeesfgtgsnhirekdgiwavlawltilah
    knkntdhfvtveeivtqywqqfgrnyysrydyeqvdsagankmmehlktkfqyfeqlkqg
    nkadiydyvdpvdqsvsknqgvrfvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqh
    etatalaniiklgleisdiaqftgrneptvit
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kfiB (B:)
    qvipaprvqvtqpyagqkpgtsglrkkvseatqpnylenfvqsifntlrkdelkpknvlf
    vggdgryfnrqaifsiirlayandisevhvgqaglmstpasshyirkvneevgnciggii
    ltashnpggkehgdfgikfnvrtgapapedftdqiythttkikeyltvdyefekhinldq
    igvykfegtrlekshfevkvvdtvqdytqlmqklfdfdllkglfsnkdfsfrfdgmhgva
    gpyakhifgtllgcskesllncdpsedfggghpdpnltyahdlvelldihkkkdvgtvpq
    fgaacdgdadrnmilgrqffvtpsdslaviaananlifkngllgaarsmptsgaldkvaa
    kngiklfetptgwkffgnlmdaglinlcgeesfgtgsnhirekdgiwavlawltilahkn
    kntdhfvtveeivtqywqqfgrnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnk
    adiydyvdpvdqsvsknqgvrfvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhet
    atalaniiklgleisdiaqftgrneptvit