Lineage for d1kfib4 (1kfi B:444-572)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2581959Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. 2581960Family d.129.2.1: Phosphoglucomutase, C-terminal domain [55958] (4 proteins)
    Pfam PF00408
  6. 2581961Protein Exocytosis-sensitive phosphoprotein, pp63/parafusin [69811] (1 species)
  7. 2581962Species Ciliate (Paramecium tetraurelia) [TaxId:5888] [69812] (2 PDB entries)
  8. 2581964Domain d1kfib4: 1kfi B:444-572 [68562]
    Other proteins in same PDB: d1kfia1, d1kfia2, d1kfia3, d1kfib1, d1kfib2, d1kfib3
    complexed with so4, zn

Details for d1kfib4

PDB Entry: 1kfi (more details), 2.4 Å

PDB Description: Crystal Structure of the Exocytosis-Sensitive Phosphoprotein, pp63/Parafusin (phosphoglucomutase) from Paramecium
PDB Compounds: (B:) phosphoglucomutase 1

SCOPe Domain Sequences for d1kfib4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfib4 d.129.2.1 (B:444-572) Exocytosis-sensitive phosphoprotein, pp63/parafusin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]}
rnyysrydyeqvdsagankmmehlktkfqyfeqlkqgnkadiydyvdpvdqsvsknqgvr
fvfgdgsriifrlsgtgsvgatiriyfeqfeqqqiqhetatalaniiklgleisdiaqft
grneptvit

SCOPe Domain Coordinates for d1kfib4:

Click to download the PDB-style file with coordinates for d1kfib4.
(The format of our PDB-style files is described here.)

Timeline for d1kfib4: