SCOPe 2.08: Domain d1ketb_: 1ket B:

Lineage for d1ketb_ (1ket B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species)

7. Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (6 PDB entries)

8. Domain d1ketb_: 1ket B: [68541]
   complexed with nad, tyd
   has additional subdomain(s) that are not in the common domain

Details for d1ketb_

PDB Entry: 1ket, 1.8 Å

PDB Description: The crystal structure of dTDP-D-glucose 4,6-dehydratase (RmlB) from Streptococcus suis with thymidine diphosphate bound

PDB Compounds: (B:) dtdp-d-glucose 4,6-dehydratase

SCOPe Domain Sequences for d1ketb_:

Sequence; same for both SEQRES and ATOM records:

>d1ketb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]}
sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg
diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh
hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv
katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail
tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde
lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevi

Timeline for d1ketb_:

• d1ketb_ first appeared in SCOP 1.59
  
• d1ketb_ appears in SCOPe 2.07