![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
![]() | Protein dTDP-glucose 4,6-dehydratase (RmlB) [51755] (4 species) |
![]() | Species Streptococcus suis, serotype 2 [TaxId:1307] [69406] (6 PDB entries) |
![]() | Domain d1ketb_: 1ket B: [68541] complexed with nad, tyd has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ket (more details), 1.8 Å
SCOPe Domain Sequences for d1ketb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ketb_ c.2.1.2 (B:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} sqfkniivtggagfigsnfvhyvynnhpdvhvtvldkltyagnkanleailgdrvelvvg diadaelvdklaakadaivhyaaeshndnslndpspfihtnfigtytlleaarkydirfh hvstdevygdlplredlpghgegpgekftaetnynpsspysstkaasdlivkawvrsfgv katisncsnnygpyqhiekfiprqitnilagikpklygegknvrdwihtndhstgvwail tkgrmgetyligadgeknnkevlelilekmgqpkdaydhvtdraghdlryaidasklrde lgwtpqftdfsegleetiqwytdnqdwwkaekeaveanyaktqevi
Timeline for d1ketb_: