SCOPe 2.08: Domain d1kbve2: 1kbv E:164-314

Lineage for d1kbve2 (1kbv E:164-314)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species)

7. Species Neisseria gonorrhoeae, AniA [TaxId:485] [419331] (2 PDB entries)

8. Domain d1kbve2: 1kbv E:164-314 [68404]
   Other proteins in same PDB: d1kbva1, d1kbvb1, d1kbvc1, d1kbvd1, d1kbve1, d1kbvf1
   complexed with cu, no2
   has additional insertions and/or extensions that are not grouped together

Details for d1kbve2

PDB Entry: 1kbv, 1.95 Å

PDB Description: nitrite-soaked crystal structure of the soluble domain of ania from neisseria gonorrhoeae

PDB Compounds: (E:) Major outer membrane protein PAN 1

SCOPe Domain Sequences for d1kbve2:

Sequence; same for both SEQRES and ATOM records:

>d1kbve2 b.6.1.3 (E:164-314) Nitrite reductase, NIR, C-terminal domain {Neisseria gonorrhoeae, AniA [TaxId: 485]}
dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget
vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn
ytlvdhsifrafnkgalgqlkvegaenpeim

Timeline for d1kbve2:

• d1kbve2 first appeared in SCOP 1.59
  
• d1kbve2 appears in SCOPe 2.07