| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
| Protein Nitrite reductase, NIR, N-terminal domain [418910] (5 species) |
| Species Neisseria gonorrhoeae, AniA [TaxId:485] [419330] (2 PDB entries) |
| Domain d1kbvc1: 1kbv C:13-163 [68399] Other proteins in same PDB: d1kbva2, d1kbvb2, d1kbvc2, d1kbvd2, d1kbve2, d1kbvf2 complexed with cu, no2 |
PDB Entry: 1kbv (more details), 1.95 Å
SCOPe Domain Sequences for d1kbvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbvc1 b.6.1.3 (C:13-163) Nitrite reductase, NIR, N-terminal domain {Neisseria gonorrhoeae, AniA [TaxId: 485]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv
Timeline for d1kbvc1: