![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Nitrite reductase, NIR, C-terminal domain [418911] (5 species) |
![]() | Domain d1kbvb2: 1kbv B:164-314 [68398] Other proteins in same PDB: d1kbva1, d1kbvb1, d1kbvc1, d1kbvd1, d1kbve1, d1kbvf1 complexed with cu, no2 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1kbv (more details), 1.95 Å
SCOPe Domain Sequences for d1kbvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbvb2 b.6.1.3 (B:164-314) Nitrite reductase, NIR, C-terminal domain {Neisseria gonorrhoeae, AniA [TaxId: 485]} dkefyivqgdfytkgkkgaqglqpfdmdkavaeqpeyvvfnghvgaltgdnalkakaget vrmyvgnggpnlvssfhvigeifdkvyveggklinenvqstivpaggsaivefkvdipgn ytlvdhsifrafnkgalgqlkvegaenpeim
Timeline for d1kbvb2: