Lineage for d1k9ba_ (1k9b A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1241472Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 1241473Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 1241474Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 1241494Species Soybean (Glycine max) [TaxId:3847] [57251] (4 PDB entries)
  8. 1241496Domain d1k9ba_: 1k9b A: [68342]

Details for d1k9ba_

PDB Entry: 1k9b (more details), 2.8 Å

PDB Description: Crystal structure of the bifunctional soybean Bowman-Birk inhibitor at 0.28 nm resolution. Structural peculiarities in a folded protein conformation
PDB Compounds: (A:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d1k9ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9ba_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Soybean (Glycine max) [TaxId: 3847]}
kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck

SCOPe Domain Coordinates for d1k9ba_:

Click to download the PDB-style file with coordinates for d1k9ba_.
(The format of our PDB-style files is described here.)

Timeline for d1k9ba_: