PDB entry 1k9b

View 1k9b on RCSB PDB site
Description: Crystal structure of the bifunctional soybean Bowman-Birk inhibitor at 0.28 nm resolution. Structural peculiarities in a folded protein conformation
Class: hydrolase inhibitor
Keywords: tripple-stranded beta hairpin, double-headed, hydrolase inhibitor
Deposited on 2001-10-29, released 2001-11-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bowman-birk type proteinase inhibitor
    Species: Glycine max [TaxId:3847]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1k9ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1k9bA (A:)
    kpccdqcactksnppqcrcsdmrlnschsackscicalsypaqcfcvditdfcyepck