Lineage for d1k83j_ (1k83 J:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309044Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2309045Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2309046Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 2309047Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 2309050Domain d1k83j_: 1k83 J: [68285]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83k_, d1k83l_
    protein/DNA complex; protein/RNA complex; complexed with mn, zn

Details for d1k83j_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin
PDB Compounds: (J:) DNA-directed RNA polymerase II 8.3kd polypeptide

SCOPe Domain Sequences for d1k83j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d1k83j_:

Click to download the PDB-style file with coordinates for d1k83j_.
(The format of our PDB-style files is described here.)

Timeline for d1k83j_: