Lineage for d1k83j_ (1k83 J:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95614Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 95615Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
  6. 95616Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 95619Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (4 PDB entries)
  8. 95621Domain d1k83j_: 1k83 J: [68285]
    Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c1, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83k_, d1k83l_

Details for d1k83j_

PDB Entry: 1k83 (more details), 2.8 Å

PDB Description: Crystal Structure of Yeast RNA Polymerase II Complexed with the Inhibitor Alpha Amanitin

SCOP Domain Sequences for d1k83j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k83j_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1k83j_:

Click to download the PDB-style file with coordinates for d1k83j_.
(The format of our PDB-style files is described here.)

Timeline for d1k83j_: