![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
![]() | Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
![]() | Protein RPB3 [64315] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
![]() | Domain d1k83c1: 1k83 C:3-41,C:173-268 [68277] Other proteins in same PDB: d1k83a_, d1k83b_, d1k83c2, d1k83e1, d1k83e2, d1k83f_, d1k83h_, d1k83i1, d1k83i2, d1k83j_, d1k83k_, d1k83l_ protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 1k83 (more details), 2.8 Å
SCOPe Domain Sequences for d1k83c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k83c1 d.74.3.1 (C:3-41,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eegpqvkireaskdnvdfilsnvdlamanslrrvmiaeiXaaaiefeydpwnklkhtdyw yeqdsakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlq kkvasillaltqmdqd
Timeline for d1k83c1: