Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.2: L-histidinol dehydrogenase HisD [69602] (1 protein) automatically mapped to Pfam PF00815 |
Protein L-histidinol dehydrogenase HisD [69603] (1 species) |
Species Escherichia coli [TaxId:562] [69604] (4 PDB entries) |
Domain d1k75b_: 1k75 B: [68254] complexed with gol, so4 |
PDB Entry: 1k75 (more details), 1.75 Å
SCOPe Domain Sequences for d1k75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k75b_ c.82.1.2 (B:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]} ntiidwnsctaeqqrqllmrpaisasesitrtvndildnvkargdealreysakfdkttv talkvsaeeiaaaserlsdelkqamavavknietfhtaqklppvdvetqpgvrcqqvtrp vasvglyipggsaplfstvlmlatpasiagckkvvlcspppiadeilyaaqlcgvqdvfn vggaqaiaalafgtesvpkvdkifgpgnafvteakrqvsqrldgaaidmpagpsevlvia dsgatpdfvasdllsqaehgpdsqvilltpaadmarrvaeaverqlaelpraetarqaln asrlivtkdlaqcveisnqygpehliiqtrnarelvdsitsagsvflgdwspesagdyas gtnhvlptygytatcsslgladfqkrmtvqelskegfsalastietlaaaerltahknav tlrvnalkeqa
Timeline for d1k75b_: