Lineage for d1k75a_ (1k75 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516419Family c.82.1.2: L-histidinol dehydrogenase HisD [69602] (1 protein)
    automatically mapped to Pfam PF00815
  6. 2516420Protein L-histidinol dehydrogenase HisD [69603] (1 species)
  7. 2516421Species Escherichia coli [TaxId:562] [69604] (4 PDB entries)
  8. 2516422Domain d1k75a_: 1k75 A: [68253]
    complexed with gol, so4

Details for d1k75a_

PDB Entry: 1k75 (more details), 1.75 Å

PDB Description: The L-histidinol dehydrogenase (hisD) structure implicates domain swapping and gene duplication.
PDB Compounds: (A:) L-histidinol dehydrogenase

SCOPe Domain Sequences for d1k75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k75a_ c.82.1.2 (A:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]}
ntiidwnsctaeqqrqllmrpaisasesitrtvndildnvkargdealreysakfdkttv
talkvsaeeiaaaserlsdelkqamavavknietfhtaqklppvdvetqpgvrcqqvtrp
vasvglyipggsaplfstvlmlatpasiagckkvvlcspppiadeilyaaqlcgvqdvfn
vggaqaiaalafgtesvpkvdkifgpgnafvteakrqvsqrldgaaidmpagpsevlvia
dsgatpdfvasdllsqaehgpdsqvilltpaadmarrvaeaverqlaelpraetarqaln
asrlivtkdlaqcveisnqygpehliiqtrnarelvdsitsagsvflgdwspesagdyas
gtnhvlptygytatcsslgladfqkrmtvqelskegfsalastietlaaaerltahknav
tlrvnalkeqa

SCOPe Domain Coordinates for d1k75a_:

Click to download the PDB-style file with coordinates for d1k75a_.
(The format of our PDB-style files is described here.)

Timeline for d1k75a_: